SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022071 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022071
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.72e-26
Family Ubiquitin-related 0.00000574
Further Details:      
 
Domain Number 2 Region: 570-621
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000657
Family UBA domain 0.0014
Further Details:      
 
Domain Number 3 Region: 204-256
Classification Level Classification E-value
Superfamily ARM repeat 0.00000691
Family Mo25 protein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022071   Gene: ENSMLUG00000007552   Transcript: ENSMLUT00000007537
Sequence length 625
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429936:1788648:1790525:1 gene:ENSMLUG00000007552 transcript:ENSMLUT00000007537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENGESSGPPRPSRGPAAAQGSASPPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKSQNRPQGQTTQPSTTAG
TTTTTTTASTPRSNSTPISTNSNPFGLGSLGGLASLSSLGLTSTSFTELQNQMQQQLLSS
PEMMLQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIA
RNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSS
SSTGEGSQPSRTENRDPLPNPWAPPSATHSSATTGTTSSSGSGSSGSSNNPGNTMAAANY
VASVFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLTQNPDLAAQMMLNNPVFSGN
PQLQEQVRPQVPSFLQQMQSPDTLSAMTNPRAMQALMQIQQGLQTLASEAPGLIPSFTPG
VGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAGPPGSTGSGSTPGPTVP
SSASSETTSPTSESGPSQQFIQQMVQALAGGNPPQLPIPEVRFQQQLEQLNAMGFLNREA
NLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences G1QED8
XP_006096219.1.53796 ENSMLUP00000022071 ENSMLUP00000022071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]