SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022125 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022125
Domain Number 1 Region: 5-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.56e-50
Family Ankyrin repeat 0.000096
Further Details:      
 
Domain Number 2 Region: 523-613
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-19
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 293-326,372-425
Classification Level Classification E-value
Superfamily TPR-like 0.0000215
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022125   Gene: ENSMLUG00000011483   Transcript: ENSMLUT00000011478
Sequence length 662
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430379:138787:140775:1 gene:ENSMLUG00000011483 transcript:ENSMLUT00000011478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRTVVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGEGTPLLIASRYGHLDVVEYL
VDRCGASVEASGSVHFDGETIEGAPPLWAASAAGHLDVVQSLLRRGASVNRTTRTNSTPL
RAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRS
AKGNTALHDCAESGSLEILQLLLGCNARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPA
GMEVQPGLAPEGPSGLGCVKSQGASCCPSSPEEPLSETYESCCPTSREAAVEALELLGAT
YVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDYSREVNTAEELEALITDP
DEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQQNNLEPL
SPMTASSFLSFAELFSYVLQDRAAKGSLGTQIGFADLMGVLCKGVREVERALQLPKEPGD
SVQFTKALAIILHLLYLLEKVECTPDQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDKDT
TNVGRYPVGRFPSLQVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPGIMNALIEAGAHM
DATNAFKKTAYELLDEKLLAKSTIQPFNYVTLQCLAARTLDKNKIPYKGFIPEELEAFIE
LH
Download sequence
Identical sequences G1QEJ2
ENSMLUP00000022125 ENSMLUP00000022125 XP_006104890.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]