SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022188 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022188
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.36e-53
Family Cyclophilin (peptidylprolyl isomerase) 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022188   Gene: ENSMLUG00000015784   Transcript: ENSMLUT00000015785
Sequence length 157
Comment pep:novel scaffold:Myoluc2.0:GL429849:1486542:1487243:-1 gene:ENSMLUG00000015784 transcript:ENSMLUT00000015785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTVFFDISIDGEPLDRISFELFVDKVPKIAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGDDFTCHNGTGSKSIYYGEKFEDKNFVLKHTGPGILSMANAGPNISFPVLICTGKTE
WLAGKHVVFHQVTAMEHFGSRNGKTSKKITISDCGQL
Download sequence
Identical sequences G1QEQ5
ENSMLUP00000022188 ENSMLUP00000022188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]