SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022232 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022232
Domain Number 1 Region: 152-252
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-26
Family Phosphotyrosine-binding domain (PTB) 0.000011
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000116
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022232   Gene: ENSMLUG00000023882   Transcript: ENSMLUT00000029391
Sequence length 455
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429953:2441798:2444359:1 gene:ENSMLUG00000023882 transcript:ENSMLUT00000029391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGAVMEGPLFLQGQRFGAKRWRKTWAVLYPASPHGVARLEFFDHKGPSSGGGRGSSRRL
DCKVIRLAECVSVVPVALESPPEPGAAAFRLDTAQRSHLLAADAPSSAAWVQMLCLNAFP
KGSWGPAPAENPPKLSALEMLENSLYSPAWERSQFWVTVQRTEAAERCGLHGSYVLRVEA
EKLTLLTAGTQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPTSPSRRHRGNDI
FQVVETAINGQRPRARHGLGPDVPKSDALEKWQSGLLACHPVAEEYLTYRRFRILNPKXQ
GRRVQLKKTLYWDLYEHVQQQLMKAKLTDPEDPIYDEPEGPGAASARGLYDLPQEPKDAW
WCQARAKEEGYELPYNPATDDYAVPPPRSTKPVPAPKPQRLTCPEPGTTGSGSKGHSSDT
ALYSQIQKSRASGDWDCGLSRVGADRTGIKSEGST
Download sequence
Identical sequences G1QEU9
ENSMLUP00000022232 ENSMLUP00000022232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]