SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022237 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022237
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.31e-53
Family Bacterial PLC 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022237   Gene: ENSMLUG00000029182   Transcript: ENSMLUT00000031220
Sequence length 287
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429904:1673906:1686720:1 gene:ENSMLUG00000029182 transcript:ENSMLUT00000031220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSHDSFSYWVDEKSPVGPDQTRAVMRLARISLVKKLMKKWSVTQNLTFREQLDAGIRYFD
LRVSSKPGDTDQEIYFIHGLFGIKVWDGLMEIDSFLTQHPREIVFLDFNHFYAMDEAHHK
YLVHRMQEAFGNKLCSACNVESLTLQILWEKKYQVLIFYHCPFYKQYPFLWPGKKIPAPW
ANTTSVRKLILFLETTLSERAPRGSFHVSQAILTPRAKTIARGLVGGLKNTLVHRNLPVI
LDWVKTQKPGTMGVNIITSDFVDLVDFATTVIELNDLLQEDRALAKC
Download sequence
Identical sequences G1QEV4
ENSMLUP00000022237 ENSMLUP00000022237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]