SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022241 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022241
Domain Number 1 Region: 4613-4749
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.85e-36
Family Synaptotagmin-like (S variant) 0.000000716
Further Details:      
 
Domain Number 2 Region: 4929-5059
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.16e-20
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 3 Region: 4412-4509
Classification Level Classification E-value
Superfamily PDZ domain-like 1.62e-19
Family PDZ domain 0.00000659
Further Details:      
 
Domain Number 4 Region: 952-1068
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000935
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.016
Further Details:      
 
Domain Number 5 Region: 522-592
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000878
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022241   Gene: ENSMLUG00000014524   Transcript: ENSMLUT00000027677
Sequence length 5063
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429818:2681620:2955247:1 gene:ENSMLUG00000014524 transcript:ENSMLUT00000027677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEASLEGEGLPEGLAAAAAAAAAGAGAGGAGSPLHTVIPAGMEADLSQLSEEERRQIA
AVMSRAQGLPRGSVPAAAAEPPPMHRKQEFDSSHPPKPPGKPPDPGRPAQPGLSKSRTTD
TLRSEQKLPGRSPSTISLKESKSRTDLKEEHKSGMMPGFLSEVNPLSAVSSVVNKFNPFD
LISDSDASQEETAKKQKIAQKEQGKPEGITKPPSQQQSPKSVPKQQGPVRAPHQQDGSPK
SVSSQQPEKVKSQPPGTGKPIQQSPSKPPTQQASPGKPPAQQPGPEKFSTPQPGPAKPSA
QQPGPAKSPAQPPGPAKPPAQQTGPPKSLAHQPGPQSPAQPPGPTKTPVQQVGLVKSLAQ
QPEPGKTPAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQ
QPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQ
QPGPAKPSVQQPGSAKPSAQQSTKPVSQTGAGKPLQPPTSPSAAQIPVQGIPKTICPLCN
TTELLLHVPEKANFNTCTGCKTTVCSLCGFNPNPDITEVKEWLCLNCQMQRALGGDLAPI
PSSPQPKPKTAAGILASVVSKPSPQSQQVSPKKDTVPKQDISKAPESKKPPPLVKQPTLH
GSPPVTAKQPHVAESSPKPATPKEPSVPSELAKGPMADDKPKQPKMAKPATDIVSSSSTA
TKPDIPSSKVQSQDQEKTTPPLKTDSAKPSQSFPPTGEKVTPFDSKVIPRPASDSKIISQ
PGPGMESKGKKQVDPVQKKEEPKKAQTKISPKPDAKPVPKGSPTPSGPRPTPGQTAPPSP
QPPKPQEQSRRFSLNLGSITDAPKSQPTTPQETMTGKLFGFGASIFSQASNLISTAGQPG
SHPQSGPGGPAKQVPPPAQPPPSQGPPKSTGQVPPAPAKVLPVKKETKAPGAEKLEPKAE
QVSTVKRTETEKKPQPIKDGKPSTAEPPKAALPPKLEKPPKPESACPLCKTELNIGSTEP
PNFNTCTECKHQVCNLCGFNPTPHLTEIHEWLCLNCQTQRAMSGQLGDMGKMPPAPSGPK
ASPMPFPTEQSPQKTAMPGQGKVKKKEQEGKTEGEKIIPEKVKETPLFEKMLPKVTTDKK
QEERKQEKDQALAPQEKKATPEDKKPPPEEDKKPPPEEKKPPPKDKKPTPEDKKFPPGAK
TSALEEEQKQTLLKTQVQVAEETPEDRVAPQAVQEKKPSPMKMEDVPPGMLQTLPEGDDG
ATQKIKDQPQEVCAAKPDQVEPGKEKTEKEDDKSDTSSSQQPKSPQGLSDTGYSSDGISG
SLGEIPSLIPSDEKDLLKGLKKDSFSQESSPSSPSDLAKLESTVLSILEAQASTLIEEKS
EKKTQPQEVSPEQPKEEQKTQSLTQSLETTVSEEKLKESHEAKDTFTKDGQQDTPPRKDH
KEKSEFVDDIATRRQPYDSVEDSSESENSPVPQRKRRTSVGSSSSDEYKQEDSQGSGEEE
DFIRKQIREMSADEDASGSEDDEFIRNQLKQISGIIESQKKEETKGKGKVTAGKHKRLTR
KSSTSFEEDAGRRHSWHDEDDETFDESPDIKYRETKSQESEELVVAGGGGLRRFKTIELN
STIADKYSAESSQKKTALYFDEEPELEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTS
VSSLDEDSDSSPSHKKGESKQQRKARHRSHGPLLPTIEDSSEEEELREEEELLKEQEKQR
ELEQQQRKSSSKKSKKDKDELRAQRRRERPKTPPSNLSPIEDASPTEELRQAAEMEELHR
SSCSEYSPSIESDPEGFEISPEKIIEVQKVYKLPTAVSLYSPTDEHSVMQKEGGQKALKS
AEEMYEEMMHKTHKYKAFPAANEREEMFEKEPLYGGMLIEDYIYESLVEDTYNGSVDDSL
LTRQEDENGFMQQRGREQKTRLPEHIYDDPMQKITDLQKEFYELESLHSIVPQEDVVSSS
YIIPESHEIVDLDSMVTSTSEEKKLLDADAAYEELMKRKQMQLTPESSPTQPPIRDDMTE
STMDYDRLPDESLTSSILSGASLTDSTSSATLSIPDVKITQHFSTEEIEDEYITDYTREI
QEIIAHESLILTYSEPSESATSVPPSDTPSLTSSVSSVCTTDSSSPVTTLDSITTVYTEP
VDIVTKLEDPGDISSSTYFQGSIIDYPEEISISLDQTTIPDGRPSTDHIAISLSDMTPSI
LESEETKPKGLIADTISTDLSISEKDSVKKAKKETGNGIILEVLEAYRDKRKDSEAELAK
TSLSETVFDQPPSGIAFPMKEQVSTACFVSGEIFGQAKPASQIPSGGPSVSSLPTKTHPF
LRSSSLDTSAQPPPPPPPPLPPHPLPSQILPPATAPYCGKPIDTAEDHRFNRLKYDMLMI
EILIKKVFTAVTSTLVFPILRIRPTEITFLLILPIAPKPPITQHPGTTQKPTDTHPKPTG
LSSNMTLNLVTTADYKLPSPTSPLSPHSNKSSPRFSLMETYVVITLPSEPGTPTDSSSQA
ITSWPLGSPLKHTIATEPVFSVVPPVTAAEMSYSSEQSLYISGALETFSAIPVTTLSSCQ
AAPISVTQFPITEVSKAEISATRSTVPSVGLSSVSVPIPPEPLALDTLHLEKHQQKENGK
LQLIGDAIDLRTAPKVEVKVTEKCMDLSASAMDVKRQTTTKEAYGRQISAVQPSIINLSA
TSSVVTPISLVTEAVTAVTCTASASYAAGTESLVSIEHATATPLQLTTSKHTEPPYRIPS
GQSFPTVKQEAPINLSLSTSAQAMTLATTKPITVPPVGVTNGWTDSTTSQGITDGEAVDL
STTKSHRTVVTMDESTSSVVTKIIEDDEKPVDLTAGRRAVCCDVVYKLPFGRSCTAQQPA
TTLPEDRFGYRDDHYQYDRSGPYGYRGVGGMKPSMSDTNLAEAGHFFYKSKNAFGYSGET
DAAVDLTSGRSSTGEVMDYSSKTAGPYPETRQVISGIGISTPQYSTARMTPPPGSQYGVG
SVLRSTNDVVYSSEATPVPSTFAITTQPGSIFSTTVRDLSGVHTTDGVTSFSTLHQSQPM
PRSYFLTTGASETDIVVTGIDINASLQTIAMETLTTETIDSVPTLTTASEVFPEVTGDES
ALLIVPEEDKQQQQLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEKMMVQKKLEE
LQSMKQHLLYQQEEERQAQFMMRQETLAQQQLQLEQIQQLQQKLHQQLEEQKIRQIYQYN
YDPSGTATPQTTTEQAMLEGQYAAPEGGQFWAAEDATTTASAVVAIEIPQSQGWYTVQSD
GVTQYIAPPGILSTVSEIPLTDVVVKDEKQPKKRSSGAKVRGQYDEIGENMAEDPRCFKK
IVDSGVQTDDEDAADRSYASRRRKTKKSVDTSVQTDDEDQDEWDMPTRSRRKTRVAKYGD
GTTEAEKTKPLSKVSSIGVQTVAEISVQTEPVGTIRTPSIRAHVDAKVEIIKHISAPEKT
YKGGSLGCQTEADSETQSPQYLSATSPPKDKKRPTPLEIGYSSHLRPDSTQQLAPSPPKS
PKVLYSPISPLSPGKALESAFVPYEKPLPDDISPQKVLHPDMAKVPPASPKTAKMMQRSM
SDPKPLSPTADESSRAPFQYTEGYTTKSSQTITPSGTQKKVKRTLPNPPPEETSTGTQST
YSPMGTVSRRRICRTNTMARAKILQDIDRELDLVERESAKLRKKQAELDEEEKEIDAKLR
YLEMGINRRKEALLKEREKRERAYLQGVAEERDYMSDSEVSSTRPSRIESQHGIERPRTA
PQTEFSQFIPPQTQTESQLVPPTSPYTQYQYSSPALPTQAPTPYTQQSHFQQQTLYHQQV
SPYQTQPTFQAVATMSFTPQAQPTPTPQPSYQLPSQMMVIQQKPRQTTLYLEPKITSNYE
VIRNQPLMIAPVSTDNTYAVSHLGSKYNTLDLRMGLEERSSMASSPISSISADSFYADID
HHTSRNFVLIDDIGEISKGTAALTTAFNLHEKDLSKTDRLLRTTETRRSQEVTDFLAPLQ
TSSRLHSYVKAEEDPMEDPYELKLLKQQIKQEFRRGAENLDHLAGLSHYYHGDTTYRHFP
KSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPKISKFSPIQESRDLEPDYSSY
MTSGTSSIGGISSRARLLQDEITYGLRKNITDQQKFVGSSLGTGLGTLGNTIRSALQDEA
DKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSLRLKAQEAEALDVSFSHASPSGRTKP
TSLPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSLP
EVQQHMREESRTRGYDRDIAFIMDDFQHAMSDSEAYHLRREETDWFDKPRESRLENGHGL
DRKLPERLVHSRPLSQHQEQIIQMNGKTVHYIFPHARIKITRDSKDHTVSGNGLGIKIVG
GKEIPGHSGEIGAYIAKILPGGSAEQTGRLMEGMQVLEWNGIPLTSKTYEEVQSIISQQS
GEAEICVRLDLNMLSDSENPQHLELHEPPKSVDKAKSPGVDPKQLAAELQKVSLQQSPLV
MSSVVEKGSHAHSGPTSAGSSSVPSPGQPGSPSVSKKKHSSSKPTDATKVVSHPITGEIQ
LQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKY
VQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNT
PRWYPLKEQTESIDHGKSHSGQSSQQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSP
GSSKSSSEGHLRSHGPSRSQSKTSVTQTHLEDAGAAIAAAEAAVQQQRLQPTKPTNHRPA
ESSVSTGSSGSSFGSGYSVDSEGSSSTAGETNLFPIPRIGKMGHNGQDPIKQPGVGVGLS
DTEVKTQVMGEIKIALKREMKTDGEQLIVEVLQCRNITYKFKSPDHLPDLYVKIYVMNIS
TQKKVIKKKTRVCRHDREPSFNETFRFSLSPAGHSLQVLLFSNGGKFMKKTLIGEACVWL
DKVDLRKRIVNWHKLLANSTQTH
Download sequence
Identical sequences G1QEV8
ENSMLUP00000022241 ENSMLUP00000013237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]