SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022337 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022337
Domain Number 1 Region: 281-339
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000327
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 81-144
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000000314
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0066
Further Details:      
 
Domain Number 3 Region: 9-96
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000128
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022337   Gene: ENSMLUG00000029547   Transcript: ENSMLUT00000027577
Sequence length 633
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430064:28128:35657:1 gene:ENSMLUG00000029547 transcript:ENSMLUT00000027577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHS
YQGHWQQGKREGLGVERKSRWTYRGEWLGGLKGRSGVWESASGLRYAGLWKDGFQDGYGT
ETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRRTSLDSGHSDPPTPPPPLPLL
GDEGGSPASGSRGGFVLAGPGDADRASSRKRTPVAGGFFRRSLLLSGLRAGGRRSSLGSK
RGSLRSEVSSEVGSTGPPGSEASGSLAPAPPALIEGSATEVYAGEWRADRRSGYGVSQRS
NGLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLALRRGKVKEKV
DRAVEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPML
EAPAVPAPGRRPRQDSEGSDTEPLDEDSPGVYENGLTPSEGSPELPSSPASCRQPWRPPA
CRNPLPPGGDRGPFSSPKTWPEEWGGPGERAEELAGYEAEDEAGIQGPGPRDGSPLLGRC
SDSSGSLREEEGEDEEPLPLIRTLGASEPEPLATPVLRGSSSRGPEAGCLMEEREEPAAT
ERPAQPGAANPLVVGAVALLDLSLAFLFSQLLT
Download sequence
Identical sequences G1QF54
ENSMLUP00000022337 ENSMLUP00000022337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]