SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022357 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022357
Domain Number 1 Region: 71-203
Classification Level Classification E-value
Superfamily Ferritin-like 2.97e-30
Family Ferritin 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022357   Gene: ENSMLUG00000022978   Transcript: ENSMLUT00000027522
Sequence length 203
Comment pep:novel scaffold:Myoluc2.0:GL429797:7350380:7350988:-1 gene:ENSMLUG00000022978 transcript:ENSMLUT00000027522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASPRICLLPQQCLDRADLGTSLLPASNHPPTSFPVTTFRTTSAILSLRNQPTPFLFLFY
LNSYFRTTVSSQIGQNYYTEVEAAATHLANLHLQASRTYLPLGFYFNQDNVALEGAGHFF
HELAKTFKGAECLLKMQTSTWSCSLPERAEAFTGSVGKTQDAMEAALALERSLNQALLEL
QALGSTHTDPQLRDFLKNHFLGE
Download sequence
Identical sequences G1QF74
ENSMLUP00000022357 ENSMLUP00000022357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]