SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022507 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022507
Domain Number 1 Region: 115-255
Classification Level Classification E-value
Superfamily PH domain-like 7.52e-55
Family Phosphotyrosine-binding domain (PTB) 0.00000218
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-17
Family SH2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022507   Gene: ENSMLUG00000027362   Transcript: ENSMLUT00000030397
Sequence length 261
Comment pep:novel scaffold:Myoluc2.0:AAPE02066385:2127:9260:1 gene:ENSMLUG00000027362 transcript:ENSMLUT00000030397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRDKEPGSFVVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLVECTPR
GVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPDRDPLEEAPDSPPQTAANSAAEL
LKQGAACNVWYLGSLEMESLTGPQAVQKALSATLAQQPPPLSTVVHFKVSAQGITLTDNQ
RKLFFRRHYPVSSVIFCALDPQDRKWVADSQACRVFGFVARKQGSATDNVCHLFAEHDPE
QPASAIVNFVSKVMIGSPRKV
Download sequence
Identical sequences G1QFM4
ENSMLUP00000022507 ENSMLUP00000022507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]