SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022514 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022514
Domain Number 1 Region: 360-504
Classification Level Classification E-value
Superfamily CBS-domain pair 5.24e-17
Family CBS-domain pair 0.007
Further Details:      
 
Domain Number 2 Region: 588-646
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000047
Family cAMP-binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022514   Gene: ENSMLUG00000024378   Transcript: ENSMLUT00000030880
Sequence length 775
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430197:244336:284665:-1 gene:ENSMLUG00000024378 transcript:ENSMLUT00000030880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGPAGGGGRPGGGPARGRLLLVALVLPVLLWARGVRGQGDPQRSTILGMRLESCDKPCGM
NPNGIIFVSEGSTVNLRLYGHRLGSISSNLISFSEVDNSEALHNSTHCPELTKDLVVQQL
VNVSRGDTSGMLVVFTKFLRRSENMKLYALCTRASVDGPWQRWTDKDSLLYMVEEAGRFL
PLWLHILIILVLLVLSGIFSGLNLGLMALDPMELRIVQNCGTEKERRYARKIEPIRRKGN
YLLCSLLLGNVLVNTSLTILLDNLIGSGLMAVASSTIGIVIFGEILPQALCSRHGLAVGA
NTIVLTKFFMLLTFPLSFPISKLLDFFLGQEIHTVYNREKLMEMLKVTEPYNDLVKEELN
MIQGALELRTKTVEDIMTQLHDCFMIRNDAILDFNTMSEIMESGYTRIPVFEDEQSNIVD
ILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNN
EGEGDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRSRKRVAEKNKRDFSAFKDTDN
ELKVKISPQLLLAAHRFLSTEVPQFSPALISEKILLRLLKYPDVIQELKFDEHNKYYVHH
YLYTRNKPADYFILILQGKVEVEAGKENMKFETGAFSYYGTMALSSLTTDRSPSHPTCLS
RSASLSCPDRTDLSSPAPLAGSSNQLGSSVLGQYISDFSVRALMDLQYIKITRQQYQNGL
LASRMETSPQFPLDGCTICTENLAEKPELPVVDETTTLLNERNATLHRASPESAI
Download sequence
Identical sequences G1QFN1
ENSMLUP00000022514 ENSMLUP00000022514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]