SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022581 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022581
Domain Number 1 Region: 14-93
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.8e-18
Family Translational machinery components 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022581   Gene: ENSMLUG00000025746   Transcript: ENSMLUT00000027792
Sequence length 141
Comment pep:novel scaffold:Myoluc2.0:GL429805:7309526:7310703:-1 gene:ENSMLUG00000025746 transcript:ENSMLUT00000027792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAAGYWGNKLGKPHTVPCKVTGTVPLLVHLIPAPRATGIVSASVPKKLLIMVSIDDCYTS
ARGCIATLGNFAKATFDAISKTYSYLTPDLWKECVHQVSLSRPTPECLCRGPRLQLWPPH
NYIQEKKQQLHFLLRVLEECK
Download sequence
Identical sequences G1QFU8
ENSMLUP00000022581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]