SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022606 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022606
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.72e-52
Family BAR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022606   Gene: ENSMLUG00000026978   Transcript: ENSMLUT00000031156
Sequence length 237
Comment pep:novel scaffold:Myoluc2.0:GL430915:19369:61195:-1 gene:ENSMLUG00000026978 transcript:ENSMLUT00000031156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGAEADKRSKKLPLTTLAQC
LMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQK
QRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAANRVEICRTKL
IILYGPRMMLQISKYTDLLEYLFILIEVQAEYHRKSLALLQAVLPQIKAQQGECTSV
Download sequence
Identical sequences G1QFX3
ENSMLUP00000022606 ENSMLUP00000022606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]