SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022621 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000022621
Domain Number - Region: 24-49
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0764
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022621   Gene: ENSMLUG00000028831   Transcript: ENSMLUT00000026798
Sequence length 49
Comment pep:novel scaffold:Myoluc2.0:GL429867:2894894:2895040:1 gene:ENSMLUG00000028831 transcript:ENSMLUT00000026798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVFSANDSTTPLDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTF
Download sequence
Identical sequences G1QFY8
ENSMLUP00000022621 ENSMLUP00000022621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]