SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022658 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022658
Domain Number 1 Region: 7-54
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000732
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 160-205
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000157
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 3 Region: 109-153
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000249
Family Elafin-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022658   Gene: ENSMLUG00000029757   Transcript: ENSMLUT00000028985
Sequence length 207
Comment pep:novel scaffold:Myoluc2.0:GL429857:3701030:3707908:-1 gene:ENSMLUG00000029757 transcript:ENSMLUT00000028985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSYTSEKAKPGACPFIYPVNCLVYEPPQCHSDWQCPKKQKCCPGLCGIKCLDPEDPSKP
DDNSNAGSIIVQWLLHNRIIQSRPLFGIHGLALLYFLPADCRVLCSYVVKPGHCPEFPLR
CPFTMIPLCRRDRICKKDKKCCFYNCRYQCLRSWEEEKAGKNGTCPFIYPVNCLVSEPPQ
CHSDWQCPKKQKCCPGSCGIKCLDPED
Download sequence
Identical sequences G1QG25
ENSMLUP00000022658 ENSMLUP00000022658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]