SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022693 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022693
Domain Number 1 Region: 23-208,268-304
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-36
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022693   Gene: ENSMLUG00000025154   Transcript: ENSMLUT00000025269
Sequence length 313
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429876:1719092:1726750:1 gene:ENSMLUG00000025154 transcript:ENSMLUT00000025269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAALDAVQRELREFPAAVRELNVPLAVPYLDQPPTPLHFYRDWVCPNRPCIIRRALQH
WPALQKWSLPYLRAAAGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPLSCVLDVLEGRA
QHPGVLYVQKQCSNLPTELPQLLSDLEPHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLLHPPSDRPFIPYEMYTPATYQLTEEGSFKMVDEEAMEKVCVLFL
GPREREGSRHKRAGVVAPCSEKPRSLGPPSAEQDRVPGSHGCIAVNFWYDMEYDLKYSYF
QLLDSLTKASGLA
Download sequence
Identical sequences G1QG60
ENSMLUP00000022693 ENSMLUP00000022693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]