SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022719 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022719
Domain Number 1 Region: 34-126
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000693
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 158-195
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000667
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022719   Gene: ENSMLUG00000026445   Transcript: ENSMLUT00000029425
Sequence length 243
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430393:76575:83623:1 gene:ENSMLUG00000026445 transcript:ENSMLUT00000029425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIFKCPPKTQPPWKEWDQKAQKNGLRHQVYAVNGDRYVGEWKDNMKHGKGTQIWKKKGA
IYEGDWKFGKRDGYGTLSLPDQEKGKYRRVYSGWWKGDKKSGGGAREAWEKRRKRGTVWV
GEGRGGGTLKASQNKTQETSWGKDNQMGDDVGSARKEENGNRYEGYWQGGLKNGPGRFFH
LDHGQLFEGFWVDNIAKCGTMIDFGRDEAPAPTQFPIPQVKIVDPDGVLEEALAMFKKKE
EPS
Download sequence
Identical sequences G1QG86
ENSMLUP00000022719 ENSMLUP00000022719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]