SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022720 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022720
Domain Number 1 Region: 286-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-47
Family SPRY domain 0.0000944
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-17
Family RING finger domain, C3HC4 0.006
Further Details:      
 
Domain Number 3 Region: 89-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000118
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022720   Gene: ENSMLUG00000026727   Transcript: ENSMLUT00000028486
Sequence length 458
Comment pep:novel scaffold:Myoluc2.0:GL429785:13573753:13575129:1 gene:ENSMLUG00000026727 transcript:ENSMLUT00000028486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFAAALAKLQEEASCSICLDYLGDPLTTECGHNFCSSCIYQRWDLLQGTFPCPVCLHHC
PDRSLKRNTQLCHMTEIVQQIPRIRGKSKRQEEPLCKKHCEGLALFCEKDLQLLCAQCSV
SSDHGDHPLMPVEEAAATHRRKLKSYIESFSEQIKDTENRSEMQVSKCFEVRERIENEKD
ELDSEVKQLKNFLEKEQSAMLISSLNETTDVEEKLMDEKNQISNYSTVLNSLLGDIISKC
LQTDMDLLTGIESIHIRYDNLEPPATFLYELKEESCSLPPHYLGLHKMIHTFQVDLTLDP
ETAHPCLIISRDRKSVTYRTAFGLHNLHGRTSYPAVLSSEGFDAGRHFWQVEVRGTGAWS
LGVCKESFPRNPPMPPFPRNGCWQFHLWANTSVTWDSGNWERIGIFLDYELGEVSFYNLR
NRSHLHTFSERFTEKLIPYFCIGLFTKSLEMHVVKDER
Download sequence
Identical sequences G1QG87
ENSMLUP00000022720 ENSMLUP00000022720 XP_006085519.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]