SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022731 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022731
Domain Number 1 Region: 164-259
Classification Level Classification E-value
Superfamily PDZ domain-like 4.15e-20
Family PDZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022731   Gene: ENSMLUG00000030248   Transcript: ENSMLUT00000024447
Sequence length 282
Comment pep:novel scaffold:Myoluc2.0:GL430148:820715:822252:-1 gene:ENSMLUG00000030248 transcript:ENSMLUT00000024447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERLGDLRVSLGTSASCHPHKGIPPLQDVPVDAFAPHRSTCTPPPQPPPVAPRPPRPNWLL
TEPLTQEGPRQSQSQSQSQGPAQSRSRSRSRSRSRGRGKSPGRRRSPSPAPILTPSMANG
RYHKPRKARPPLPRPLDGQVAKARGSQGPSENGPGRTAEQAATKAPSGELRTVTLSKMKQ
SLGISISGGIESKVQPMVKIEKIFPGGAAFLSGALQAGFELVAVDGESLEQVTHQRAVDT
IRRAYRNKAREPMELVVRVPWPDPPALPSDSSAPSDRLLPPD
Download sequence
Identical sequences G1QG98
ENSMLUP00000022731 ENSMLUP00000022731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]