SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022745 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022745
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.14e-20
Family Ubiquitin-related 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022745   Gene: ENSMLUG00000023344   Transcript: ENSMLUT00000024756
Sequence length 117
Comment pep:novel scaffold:Myoluc2.0:GL429786:1829215:1830047:-1 gene:ENSMLUG00000023344 transcript:ENSMLUT00000024756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLKVEPSDTIENVKAKVQDRDFVGKQLEDGCTLSNYNIQKESTLHLV
LPPQGGLIDLSLCQLAQKYNCNKTICLKFCGHLHPCTIYCHKKCGHTNNLRRRKTIQ
Download sequence
Identical sequences G1QGB2
ENSMLUP00000022745 ENSMLUP00000022745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]