SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022766 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022766
Domain Number 1 Region: 137-305
Classification Level Classification E-value
Superfamily Cyclophilin-like 9.2e-18
Family Cyclophilin (peptidylprolyl isomerase) 0.0000301
Further Details:      
 
Domain Number 2 Region: 9-106
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000136
Family Canonical RBD 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022766   Gene: ENSMLUG00000027940   Transcript: ENSMLUT00000022406
Sequence length 306
Comment pep:novel scaffold:Myoluc2.0:GL430027:154181:173252:1 gene:ENSMLUG00000027940 transcript:ENSMLUT00000022406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPKELGAFVGGLTEEVDGKILYAAFTFFGDITDIQIPLEYGTEKHQGFAVVELELAEDY
DRLGASEEMNESEFFGRTIGVNLTKPVMGIKEGSSRPAFTALFWHQFFKGRTLSDTEAQE
GGCPPWSQCSQRRGPAKEALSNPQVSMDIKTGSKPTSRIQTLLRSDVVSMTTAPAYVTHT
CTCTHTRSLCGCLCVRSLHRCLCPWPHSVMAVGTVLFSVTFFFFTEEYFLLSFPPPGLLS
MANSGPNTNGSQFFLTCDKTXPGGGRLLQKEAALLGLGMVPPAKAQGSKDGKPKEKVIIS
DCGEYV
Download sequence
Identical sequences G1QGD3
ENSMLUP00000022766 ENSMLUP00000022766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]