SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000416 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000416
Domain Number 1 Region: 19-114
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-23
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000416   Gene: ENSMLUG00000000457   Transcript: ENSMLUT00000000458
Sequence length 691
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:14698410:14729305:1 gene:ENSMLUG00000000457 transcript:ENSMLUT00000000458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIWASVNSTGVVDKSMETKKTLYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIID
LNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTE
EDPVKPPGSSLQVDLPSAVITTPPSAQVDSSSGAQPPPYQLINLPPHLETVGIQEDPQDY
LLLINCQSKKPEPTRTHADSAKSTSSDTDCNDNVPAHKNPASSQSKHGVNGFFQQQIMYD
SPPPRAVSVSADSSLYNLPRSYSHDVLPKASPSSTEADGELYVFNTPSGTSSIETQMRHV
SISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETGSIT
RTASDTDSSYCVPTAGMPPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSLEGF
HNHFKIKNVSTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFS
SFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKAKPAPLEIKPLPEWE
ELPAPVRSPITRSFARNSSRFPMSPRPGSVHSTTSSSDSHDSEENYVPMNPNLSGEDSNL
FGSSSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKISGSGSNVADERVDYVVVD
QQKTLALKSTREAWTDGRQSTESDTPTKSVK
Download sequence
Identical sequences G1NTC6
ENSMLUP00000000416 ENSMLUP00000000416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]