SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000610 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000610
Domain Number 1 Region: 69-171
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-23
Family SH2 domain 0.00026
Further Details:      
 
Domain Number 2 Region: 164-209
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000144
Family SOCS box-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000610   Gene: ENSMLUG00000000674   Transcript: ENSMLUT00000000669
Sequence length 210
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429943:1840142:1840774:-1 gene:ENSMLUG00000000674 transcript:ENSMLUT00000000669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAISAAAEPRRRPEPSSSSSTPAALVRPRPCPAVPTPAPGDTHFRTFRSH
ADYRRITHTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMSS
GPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQR
IVATVGRENLGRIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences G1NTU4
ENSMLUP00000000610 XP_006096407.1.53796 ENSMLUP00000000610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]