SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001730 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001730
Domain Number 1 Region: 569-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000389
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 606-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000398
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000824
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000783
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001730   Gene: ENSMLUG00000001899   Transcript: ENSMLUT00000001901
Sequence length 702
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429928:2908865:2916279:1 gene:ENSMLUG00000001899 transcript:ENSMLUT00000001901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAACAPTTSVSDDCSISAGMRPGPVPGPFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTIATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSSSAGRAYLHQEHAPRQG
AAPAADGLCLPPKHPVPDFVGAAMAGTLRPHPQAPPPIPACGARESIKREATSALSVTSP
TPAKWGLSKKSKEQPDRALDTSGPPRGQGHFLGIMGGSPAGGGGLAFYPGVRSAFRPATL
ARTTATALGDAYREEGGGKSGAGLLGGGRAGGRPGSRENPTAGGLGHHHHHHAHHHHHPK
CLLTGDPPLPPPPGLPCSEALRIPLLPGPREEASAFKHVERAPPAAAALPGARCAQLPPA
TGVHLERCALPALGASGLKAYPGSECSHLPAVMPAFTVYNGELLYGSPAAAAYYPLKLHF
GGLLKYPESISYFSGPAAAAAATLSPAELGSLASIDREIAMHTHQLSEMASGKAAARLDV
GPLPPAVVPSGGAGGGGGGGGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCK
VCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPSQNLLAKAGD
GPGAEPDYPLDLGESKSDNDSDVDVCFADDQSDPEAGGGGER
Download sequence
Identical sequences G1NWL6
ENSMLUP00000001730 ENSMLUP00000001730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]