SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001797 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001797
Domain Number 1 Region: 247-317
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-17
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 153-234
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000866
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001797   Gene: ENSMLUG00000001974   Transcript: ENSMLUT00000001974
Sequence length 380
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:9121434:9135273:-1 gene:ENSMLUG00000001974 transcript:ENSMLUT00000001974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRKPSNASEKESTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVP
TPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDCSLDS
PGPEKMALSFSEQEERELPALSRQTSTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARV
HTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGRLGSFKFIYVDVLPEEAVGPA
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNITDP
QHRAKLLTAAELLLDYDTGSEEAEEGGDSIQEPAVHTLSDPKGDIPRDSGCFEGSESGRD
EAELVGAEEQLQGLSLAGAP
Download sequence
Identical sequences G1NWS6
ENSMLUP00000001797 XP_006082186.1.53796 ENSMLUP00000001797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]