SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002071 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002071
Domain Number 1 Region: 74-314
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.05e-30
Family Protein-L-isoaspartyl O-methyltransferase 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002071
Domain Number - Region: 337-354
Classification Level Classification E-value
Superfamily SOCS box-like 0.0562
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002071   Gene: ENSMLUG00000002277   Transcript: ENSMLUT00000002275
Sequence length 357
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429880:3369523:3394359:1 gene:ENSMLUG00000002277 transcript:ENSMLUT00000002275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWKHGN
IHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTMVGLILGPFGINHGIELHSDVVEY
AKEKLESFIKNSDSFDKFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKIL
LKVGGILVMPIEDQLTQIMRTGQNTWESKNILAVSFAPLVQLLRMVPGSWETPGNLSPCA
VRNLQDLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQP
LDSEEDEKMEEDKEEEEKDDSDAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFREK
Download sequence
Identical sequences G1NXH3
ENSMLUP00000002071 ENSMLUP00000002071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]