SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002154 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002154
Domain Number 1 Region: 542-633
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.45e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 411-583
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002154   Gene: ENSMLUG00000002369   Transcript: ENSMLUT00000002370
Sequence length 729
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:109354:242700:1 gene:ENSMLUG00000002369 transcript:ENSMLUT00000002370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQPPPAPAPPAPQQPPGPLLQPQP
QPLQQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPLSNSTAILHP
SSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSG
GVMKPLSRLSASRRNLIEAEPEGQPLQLFSPGNPPEIVVSSREDNHAHQTLLHHPNATHN
HQHAGTTPSGTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIET
ELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYER
ILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVM
LLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCE
RYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVV
ARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQR
KFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESK
LEHLTASFNALPVLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPLSDSPIGVSSTSFP
TPYTSSSSC
Download sequence
Identical sequences G1NXP9
XP_006095150.1.53796 ENSMLUP00000002154 ENSMLUP00000002154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]