SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002215 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002215
Domain Number 1 Region: 1252-1318
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.1e-20
Family TB module/8-cys domain 0.00000887
Further Details:      
 
Domain Number 2 Region: 577-645
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1427-1487
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-17
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1036-1159
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.22e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 914-1030
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 458-528
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000017
Family TB module/8-cys domain 0.0036
Further Details:      
 
Domain Number 7 Region: 821-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.007
Further Details:      
 
Domain Number 8 Region: 524-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000039
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 1152-1205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000527
Family EGF-type module 0.017
Further Details:      
 
Domain Number 10 Region: 780-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000195
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 11 Region: 1563-1614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 12 Region: 1533-1578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000425
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1373-1419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000495
Family EGF-type module 0.004
Further Details:      
 
Domain Number 14 Region: 1340-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.022
Further Details:      
 
Domain Number 15 Region: 858-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000028
Family EGF-type module 0.005
Further Details:      
 
Domain Number 16 Region: 309-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000303
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002215
Domain Number - Region: 96-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1197-1223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00984
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002215   Gene: ENSMLUG00000002425   Transcript: ENSMLUT00000002437
Sequence length 1629
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429901:2639006:2974861:1 gene:ENSMLUG00000002425 transcript:ENSMLUT00000002437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGLRPPPPPPPEPARPRSGGQLHPQPGGTRRAVPDRQTKAGKPRDPKVPQEEQSGGGSR
LKAQQKQQLQGVNVCGGQCCQGWSKAPGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTK
GKACEMTAAQDTSSPVFAGQGPGAAASWVPPEQASKRTSSKKADTLPRVSPVAQMTLTLK
PKPSVGLAQQIHSQVTPLSSQNVVIHHGQTQEYVLKPKYFAAQKVISGEQSTEGSFPLRY
GPDQVAAPFQLSNHTGRIKVVFTPSICRVTCTKGSCQNSCEKGNTTTLISENGHAADTLT
ATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHSQQSGKALG
THVVHSTHTLPLTMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGPTGQKVKEA
QPGQSQISYQGLPVQKTQTVHSTYSHQQVIPHIYPVAAKTQLGRCFQETVGSQCGKALPG
LSKQEDCCGTVGTSWGFHKCQKCPKKPSYHGYNQMMECLQGYKRVNNTFCQDINECQLQG
VCPNGECLNTMGSYRCTCKMGFGPDPTFTTCVPDTPVISEEKGPCYRLVSSGRQCMHPLS
VHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGP
VFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVLVATAPPEKEIPSLD
QEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVIAPTQVT
EINECSVNPDICGAGHCVNLPVRYTCICYEGYKFSEQQRKCTDIDECTQAPHLCSQGRCE
NTEGSFLCICPAGFMASEEGTSCIDVDECLRPDVCGEGHCINTVGAFRCKYCDSGYRMTP
GGHCEDIDECLSPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLDPKVCTNGT
CSNLEGSYMCSCHKGYTPTPDHKHCKDIDECQQGNLCMNGQCKNTEGSFRCTCGQGYQLS
AAKDQCEDIDECQHRHLCTNGQCRNTEGSFRCVCDQGYRASALGDHCEDINECLEDNSVC
QGGDCINTKGSYDCTCPDGFQLNDNKGCQDINECEQPGLCGPRGECLNTDGSFHCVCEQG
FTISADGRTCEDIDECVNNTVCDRHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECEL
LSGVCGEAFCENVEGSFLCVCADETQEYSPMTGQCRSRAPGDLNVEVEQSREEKKECYYN
LNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTEMCPRGKGFVPTGE
SSYEAGDKDYKDADECLLFGQEICKNGFCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQ
DPNSCIDGQCINTEGSYNCFCTHPMVLDASEKRCVRPSESHEQIEETDVYQDLCWEHLSD
DYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRQPYGRDA
LVDFSEQYAPEADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYH
LDMAKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDKPNYCTPLNTAL
NLDKDSDLE
Download sequence
Identical sequences G1NXV0
ENSMLUP00000002215 ENSMLUP00000002215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]