SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002502 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002502
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 1.03e-16
Family PX domain 0.006
Further Details:      
 
Domain Number 2 Region: 203-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000366
Family BAR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002502   Gene: ENSMLUG00000002755   Transcript: ENSMLUT00000002751
Sequence length 404
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429809:7786983:7813541:-1 gene:ENSMLUG00000002755 transcript:ENSMLUT00000002751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVPEVLQQQDEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS
PEFSVIRQHEDFVWLHDTLSETADYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFSGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVESRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LSNFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Download sequence
Identical sequences G1NYK7
ENSMLUP00000002502 XP_006088043.1.53796 XP_006088044.1.53796 ENSMLUP00000002502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]