SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002845 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002845
Domain Number 1 Region: 557-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.11e-81
Family Protein kinases, catalytic subunit 0.00000000339
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2e-60
Family Ephrin receptor ligand binding domain 0.00000439
Further Details:      
 
Domain Number 3 Region: 271-425
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-20
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 4 Region: 863-930
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.11e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002845   Gene: ENSMLUG00000003124   Transcript: ENSMLUT00000003131
Sequence length 934
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429895:2606396:2626413:1 gene:ENSMLUG00000003124 transcript:ENSMLUT00000003131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDSINEVDESFRPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPG
VLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRKLNTEVRGVG
PLSKRGFYLAFQDIGACLAILSLRIYYKKCPTMVRNLAAFSEAVTGADSSSLVEVRGQCV
RHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERQDACVGERAPCGLAGGLRRGRLPGG
PVRIGTGSDRVRCPYNKYPPPSSPCYSLRPGPPSAPVNLISSVNGTSVTLEWAPPLDPGG
RSDITYNAVCRRCPWALGHCEKCGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVN
GVSDLSPEPRQAAVVNITTNQAGPADASPTKSQSRSGPGQTSVSLLWQEPEQPNGIIRYE
IKYYEEVPASGRRGGWRTRAGGALGWTRPRGPLVPSLRAAPSPASRGLFLPSGSLQGGGA
RIGGFKGPRYDTRTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQ
EPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGESGEVCYGRLRVPGQQDAVAIKALKAG
YTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQF
TIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDGNLVCKVSDFGLSRVLEDDPDAA
YTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVE
EGYRLPAPMGCPRALHQLMLDCWHKDRAQRPRFSQIVSILDALIRNPESLRTTATLCPRC
PAPAFARSCFDLRGGGAGSGGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVR
ALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences G1NZF7
ENSMLUP00000002845 ENSMLUP00000002845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]