SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003122 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003122
Domain Number 1 Region: 45-121
Classification Level Classification E-value
Superfamily HMG-box 4.32e-29
Family HMG-box 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003122   Gene: ENSMLUG00000003435   Transcript: ENSMLUT00000003432
Sequence length 232
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430457:306431:307827:-1 gene:ENSMLUG00000003435 transcript:ENSMLUT00000003432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPGLSQDRAWSLEPPTPTAPASSPSGSQEREDAESPVVSGGLPLEKVKRPMNAFMVWS
SAQRRQMAQQNPKMHNSEISKRLGAQWKLLGEDEKRPFVEEAKRLRARHLRDYPDYKYRP
RRKTKSAGAGLPHFGQGSGGVAVSGPVWGPGYVTTQGSRGFGYQPPNYSTSYLPRGFSSS
HSKPEASTCSLHQSNPRLQGELLPHYNPYPPPGSPTPYNPPLSGAPMPLAHL
Download sequence
Identical sequences G1P054
ENSMLUP00000003122 XP_006105574.1.53796 ENSMLUP00000003122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]