SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003314 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003314
Domain Number 1 Region: 141-279
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-27
Family Cadherin 0.00024
Further Details:      
 
Domain Number 2 Region: 259-353
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000002
Family Cadherin 0.00077
Further Details:      
 
Domain Number 3 Region: 382-493
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000814
Family Cadherin 0.009
Further Details:      
 
Domain Number 4 Region: 79-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000563
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 499-587
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000166
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003314   Gene: ENSMLUG00000003641   Transcript: ENSMLUT00000003640
Sequence length 1119
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429860:2086881:2106859:-1 gene:ENSMLUG00000003641 transcript:ENSMLUT00000003640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVLNNFIFQICFHFGNALHFETLHTRNANEPPPKHAHSVRQKRAWITAPVSLREGEDLSR
KNPIAKIHSDIAEERRIKITYKYTGKGITEPPYGVFVFDKDTGELNVTSILDREETPYFL
LTGYALDERGNNLEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDA
DEPNSMNSKISYKIVSQEPANPPMFYLNKDTGEIYTVSNTLDREERSSYTLTVEARDGKG
EVTDKPVKQAQVQIRILDVNDNIPMVESQRYEGTVEENRVHVEVTRIKVLDADERGSDNW
LANFTFASGNERGYFRIETDNQTNEGIVILIKELDYEEIKHLDFSVIVTNKAPFHKSVKS
QYKPTPIPIKVKVKNVKEGIHFRSSTISIRTSESMEKTSLSQVIGKFEAFDEDTGKVARV
KYTKLEDIDSWVSVDSVTSEIKLVKFPDFESRYVQNGTYTVKILAISEDSPRKTITGTVV
ITVEDINDNCPTLVDPVLNVCDDVQYVNVTARDLDGYPNSDPFTFVIIDKPAGMAEEWKI
VHKESTSVLLQQRERKPGRSDIQLLISDSQGFSCSEKQILKLTVCKCLDGSSCVEVLHGG
YVGLGPAAIALIILALLLLLLVPLLLLMWHCGEGAKGFAPIPGTVEMLHAWNNEGAPPED
KVVPSLLTADQRESVAVGSGVGGVAAKETTVKGGSSASFTRVQHDMSEVDGRWEEHRSHL
SGGTTQVTGTAGALQGGETIRTTRATGIYRDMAGARAAAAAAMSEEFLGSYFTEKAACYT
EEDDCLVGKDCLLLYSQEDTESLHGSIGCCSFIEGELDDHFLDDLGLKFRTLAEVCLGRK
IEMGLEVEQRPAPVRESASHSLSEQTRVHSESSFSSAGSVQVPTSVLEASAEEITRETVT
ERVVSSKQGQQVAAQLPDPLAAGNVIVTETSFATGLTGPPPAVVLGPRQPQGLIVTERVY
APASAAGDQRCAHQHYAHQHYANEGNITVTERLIQPSGGLSGALEGTAHLPDGHYVMVRE
RESFLAPSSGVQSARAQASAAGGRSVTVTERVLTPASTLQSSAPVAPQTAMTARTVVTGA
VIPGPPPSFSSEESGHSGCTVTTASTRVSKHSTVQHSYA
Download sequence
Identical sequences G1P0M4
ENSMLUP00000003314 ENSMLUP00000003314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]