SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003318 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003318
Domain Number 1 Region: 274-538
Classification Level Classification E-value
Superfamily Kelch motif 4.05e-42
Family Kelch motif 0.0078
Further Details:      
 
Domain Number 2 Region: 634-809
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-26
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 21-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-20
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 4 Region: 946-992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000213
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003318   Gene: ENSMLUG00000003642   Transcript: ENSMLUT00000003645
Sequence length 1151
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429811:6158756:6292714:1 gene:ENSMLUG00000003642 transcript:ENSMLUT00000003645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCTGGVLRPGLWGLGRNRLSLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHF
ATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNESVPEVVTTSGYALLHFFSDAAYN
LTGFNIFYSINSCPNNCSGHGKCTTSVSVPSQVYCECDKYWKGEACDIPYCKANCGSPDH
GYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMW
VIGGYSFNYSSFQMVLNYNLENSIWNVGTLSRGPLQRYGHSLALYQENIFMYGGRIETNE
GNVTDELWIFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMELDSRDVVMIIIFGYSAIY
GYTSSVQEYHISSNTWLVSETKGAIVQGGYGHTSVYDEITKSIYVHGGYKALPGNKYGLV
DDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFL
AYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDILVYKPPNCKAF
RNEELCKNAGPGIKCIWNKSYCESWESGNTNNILRAKCPPKTAASEDRCYRYADCASCTA
NTNGCQWCDDKKCISANSNCSVENKKSVKNYTKCHVRNEQICNKLTSCKSCSLNLNCQWD
QRQQECQALPAHLCGEGWNHIGDACLRINTSRESYDNAKLYCYNLSGNLASLTSSKEVEF
VLDEIQKYTQQYSFTQMKVAPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSGFCA
YLERAAVAGLKANPCTSMADGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMW
CSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTG
RGHCIEGSSRGPMKLVGTHSNEMVLDSSLCPKEKNYEWSFIQCPACQCNGHSTCINNNVC
EQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHMHTGKCFCTTKGIKGDQC
QLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSNKNLDISI
NASNNFNLNITWSVGSTAFFQFTQISDVSVCVYRDSFSYEKFNFRSNPNITFYVYVSNFS
WPIKIQVSVKI
Download sequence
Identical sequences G1P0M8
ENSMLUP00000003318 ENSMLUP00000003318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]