SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003867 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003867
Domain Number 1 Region: 1020-1141
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.17e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 2 Region: 157-192,226-373
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-31
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 3 Region: 871-1045
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.78e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0093
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 7.52e-19
Family Phosphotyrosine-binding domain (PTB) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003867   Gene: ENSMLUG00000004239   Transcript: ENSMLUT00000004246
Sequence length 1253
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429815:6101775:6293557:-1 gene:ENSMLUG00000004239 transcript:ENSMLUT00000004246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPNEAWVAFSLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSKKEPG
TKQVRLCVSPSGLRCEPEPEKTQQWDPLICSSIFECKPQHAHKLIHNSHDPSYFACLIKD
DAASRRSICYVFKADDQTKVPEIISSIRHAGRIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHISCSRDKFRSVLQPAGPTEQGHWPMRKSFSQPGLRSLA
YRKEFQDGSLRSHSFFSSFDENDIENHLISGHNIVQPTDIEENRTMLFTIGQSEVYLISP
DTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALVDEIMM
TLKQAFTVAAVQQTRAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTTLTNQEQ
AMVFEEVQKLRPRNEQRENELVISFLRCLYEEKQKVHTHIGDVKQTTQIAAENIGSELPS
SATRFKLDMLKNKAKRSLAESLESILSRGNKARGLPEHSASLDLDGSVSSTLNNTNKEPC
VCDKEASPASESRTRLLGSSDDLLSGDTESPPTEEPALLSPQQGYRRRANTLSHFPVECQ
EPPEPAQGSPGGSQRKLMRYHSVSTETPHERNGNHPPVGESKSCSGPSVPAPPPRLNPSD
SSPNFFKSLKHNTSGEQSGNAVPKSISYRNALRRKLHSSSSVPNFLKFLAPVDENNTSDF
MSTKRDLDAKAHPLGDPSGTPVKTRRHSWRQQIFLRVATPQKASDSPSRYEDYSELGELP
PRSPLEPVCEDGPFGPVPEEKRRTSRELRELWRKAILQQILLLRMEKENQKLQASKNDLL
NKRLKLDYEEITPCLREVTAVWEKMLSTPGRSKIKFDMEKMHSAVGQAIVPRHHRGEIWF
LAEQYHLKHQLPPTQQPSSAPWKHISPSVTFQERRRLMVLVFTGRTFPTHPYFSAQLGAG
QLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMGEEEAFHMLKFLMFDRGLRKQYRPD
MIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFDM
IFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTINQVFEMD
ISKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLEQLQVANGRIQ
SLEATVEKLLTNESKLKQAALALELERSALLRTVEELQRRTAELRAPQPDLVQ
Download sequence
Identical sequences G1P1Z5
ENSMLUP00000003867 ENSMLUP00000003867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]