SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003880 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003880
Domain Number 1 Region: 340-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-34
Family SPRY domain 0.00022
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily RING/U-box 9.72e-26
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 87-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.51e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003880   Gene: ENSMLUG00000004259   Transcript: ENSMLUT00000004260
Sequence length 505
Comment pep:novel scaffold:Myoluc2.0:GL431110:41258:52801:1 gene:ENSMLUG00000004259 transcript:ENSMLUT00000004260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEILVNIKEMMTCPICLGILKEPRSLDCGHSFCQACITANNKESVNGQGESSCPVCRI
SYQPENLRPSLHLANIVEVLREVKLSPEEDQKSDLCVHHGEKLLLFCQEDGKIICWLCER
SQEHRGHQTFLIEEITQECKEKLQKALDSLSAKQQEAEKLRADLEKETTSWKDLIENEIQ
SIQDYFKELRGILDSEEQKELQRLEKEERDVLSYLAQGGSELIQKGQLLRDLTWDLQRRL
QGSTAEMLQDVNGILESPRSKTFTLKKLKTLPKKQRRVFQVPDLRGMLQVFNELAVVRRY
WGSYSFYSDDLSCNVISNTNMTLNHRSNVDISAHKRNGRGDFYRRALCPPEREDYVVLGF
PSITSGKHYWEVDVPKNKDWILGVCIRKYPDFTGIDFGGKNKPVSFQYQPQNGYWVIGLQ
NYSEYQAFVNSSYSNPSPLTLFVTVPPDRIGVFLDFAACTISFLNITNHGFLIYKFSSCR
FYQEIYPYFNSMEYPGSLKLVSPSS
Download sequence
Identical sequences G1P207
ENSMLUP00000003880 ENSMLUP00000003880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]