SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003909 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003909
Domain Number 1 Region: 7-85
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-19
Family PDZ domain 0.00054
Further Details:      
 
Domain Number 2 Region: 368-432
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.09e-18
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 309-372
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.23e-17
Family LIM domain 0.032
Further Details:      
 
Domain Number 4 Region: 280-307
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000785
Family LIM domain 0.005
Further Details:      
 
Domain Number 5 Region: 428-453
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000352
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003909   Gene: ENSMLUG00000004289   Transcript: ENSMLUT00000004292
Sequence length 458
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:2283945:2299146:-1 gene:ENSMLUG00000004289 transcript:ENSMLUT00000004292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGG
LTHIEAQNKIRACGEHLSLGLSRAQPAQSKPRKALTPALDSPRYTFAPSTSLNKTARPFG
APLLADSTPQQNGQPLRPLVPDASKQRLMEDTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEHLKKSSQVPRTEAPVPASATPQEPWPGPTTPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQNRTSIVQAAAGGGTGGGGGSNGKTPVCHQCHKVIRGRYLVALGH
AYHPEEFVCSQCGMVLEEGGFFEEKGAIFCPPCYDMRYAPSCAKCKKKITGEIMHALKMT
WHVHCFTCTACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGF
SWHDTCFVCAICQINLEGKTFYSKKDKPLCKSHAFSHV
Download sequence
Identical sequences G1P233
ENSMLUP00000003909 XP_006081687.1.53796 XP_006081688.1.53796 ENSMLUP00000003909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]