SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004224 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004224
Domain Number 1 Region: 721-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000867
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 491-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000119
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 80-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000631
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 539-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000326
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 629-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000135
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 783-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000028
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 7 Region: 582-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000003
Family Classic zinc finger, C2H2 0.071
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004224
Domain Number - Region: 180-306
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00113
Family Galactoside acetyltransferase-like 0.027
Further Details:      
 
Domain Number - Region: 137-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00468
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004224   Gene: ENSMLUG00000004634   Transcript: ENSMLUT00000004642
Sequence length 890
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430322:329144:334745:-1 gene:ENSMLUG00000004634 transcript:ENSMLUT00000004642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRLLGSSKSGPGKDGSQNEVRLPVRHDPKLGLPVARGGQTMPSQAPLCFD
PGSPASDRTEGKKKGRPKAENQALRDIPLSLMTQWKDEFKVHSRVKCPSSGCWLEFPSIY
GLKYHYQRCQGGAISERLTFPCPFCEAAFTSKTQLEKHRIWNHMDRPLSAPKPGPVSRPV
TISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPVPVTKPVTISRPVPVTKPV
TISRPVPVTKPVPVSRPVPVTKPVPVSRPVPVTKPVPMTKLVTVTKPVPVTKAVTVSRPI
VVSKLVTVSRPMAISRHTPSCKMVLLTKSENKTPRATGRASGKKRAADSRDACPLPPKQA
RSESGECGPPTTGQGSALQPSTDPSSGPLSLGSRPLGGKEVPRATGPVSLPEEGAERMKH
RRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKSRGYRAKKQEGPGPEDVRKKAPAPANTV
SKEAPAPVAHSTPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDAL
KCQHCRKQFKSKAGLNYHTMAEHSAKPSDTEASEGSEQEERERLRKVLKQMGRLRCPQEG
CGAAFSSLMGYQYHQQRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHMRSEHTAPPPEE
PQDKPPEAEDLLGIERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETA
RLNYTRPGLPTLNPQLLETWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGDHL
VEKYRCLLCPKEFSSESGVKYHILKAHAENWFRTSADSPPKHRSQGSLVPKKEKSLAGGK
KRGRRPKERLPEEPAPKMAPRQEDWPPGGRDKGAQDSTGRKVGASNSPEK
Download sequence
Identical sequences G1P2W5
ENSMLUP00000004224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]