SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004375 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004375
Domain Number 1 Region: 91-173
Classification Level Classification E-value
Superfamily HMG-box 2.88e-20
Family HMG-box 0.0000356
Further Details:      
 
Domain Number 2 Region: 214-310
Classification Level Classification E-value
Superfamily HMG-box 1.44e-19
Family HMG-box 0.0000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004375   Gene: ENSMLUG00000004811   Transcript: ENSMLUT00000004804
Sequence length 381
Comment pep:novel scaffold:Myoluc2.0:GL429873:418549:419691:-1 gene:ENSMLUG00000004811 transcript:ENSMLUT00000004804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTSSEDNWCEEDIAELLERMENNLPPNDKHTFKTTQSQMDWVKVAFKDYSGEMCKLKW
LEISYKLRKIRTMKELVLEAKEHVKNSYKSKMCKIHPDMPKQPLTPYLRFFKEKRPLYAQ
MYPKLTNQELTKVMSEKYKELPEEKKMKYIQDFQKERQEYQEKLAQFRKDCSELVQDSKT
SVVPKRSPTRGPKKFQGKGKDVMSSPENDFSEEIKFHGEPEKPPMNEYHKFHQDMWSSRE
LQGLPLRKRMVEISRRWQCVPRSQREHYKQQAEELQKQYKVDLEHWLKSLSPEEYAAYRE
RTSGKRKNMNMRGGPDPKINRTDVQSPPSGTMQGGLAQEQELQAPGMESSGTLQGSEEKK
EYGGKAEGIASSDSSSEDEDV
Download sequence
Identical sequences G1P392
ENSMLUP00000004375 ENSMLUP00000004375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]