SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005390 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005390
Domain Number 1 Region: 268-358
Classification Level Classification E-value
Superfamily Fibronectin type III 4.08e-17
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 137-199
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000129
Family Ankyrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005390   Gene: ENSMLUG00000005890   Transcript: ENSMLUT00000005898
Sequence length 763
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429925:1035665:1154721:1 gene:ENSMLUG00000005890 transcript:ENSMLUT00000005898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSFSKYMLSTSRVFCCNKIIGRRFACFVQRLSHRRRQSQCDLLNESTGQSPATCSSAA
SNNLNWNCRVKMTQQMQSLHLSQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFR
ARTDRLSLRKTSVNFQGNEAMFEAVEQQDMDAVQILLYQYTAEELDLNTPNSEGLTPLDI
AIMTNNVPIARILLRTGARESPHFVSLESRAMHLNTLVQEAQERVSELSIQVENEGFSLD
NTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEVPTNVCLMVTSSTSLTVSFQEPLSVNAA
VVTRYKVEWSMSKDFCPLAGEIIMEDLQTLRCTITGLTTGQQYFVQVSAYNMKGWGPAQT
TTPTCASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRESSKLQTTGRKQSVS
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNMLVTNEDQIPIVEIDDSHTSSITQDFLW
FTKLSCMWEDIRWLRQSVPISMSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKD
RHGNILIVTIREVEMLYSFFNGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYH
KRSHQRLSPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRENHNISKEEWEWVQKLS
GSESMESVDHTSDCPMQLFFYELQMAVKALLKQINIPLHQARNFRLYTQEVLEMGHNVSF
LLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences G1P5T3
ENSMLUP00000005390 ENSMLUP00000005390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]