SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005839 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005839
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.62e-51
Family N-terminal domain of cbl (N-cbl) 0.000000567
Further Details:      
 
Domain Number 2 Region: 200-286
Classification Level Classification E-value
Superfamily SH2 domain 1.87e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 292-370
Classification Level Classification E-value
Superfamily RING/U-box 7.51e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 115-199
Classification Level Classification E-value
Superfamily EF-hand 4.76e-38
Family EF-hand modules in multidomain proteins 0.00000612
Further Details:      
 
Domain Number 5 Region: 791-829
Classification Level Classification E-value
Superfamily UBA-like 0.0000715
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005839   Gene: ENSMLUG00000006385   Transcript: ENSMLUT00000006393
Sequence length 842
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430726:71332:133150:1 gene:ENSMLUG00000006385 transcript:ENSMLUT00000006393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMK
KTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDAFRITKA
DAAEFWRKAFGEKTIVPWKSFRQALHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIF
TRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWA
IGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVT
QEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIK
GTEPIVVDPFDPRGSGSLLRQGAEGASSPNYDDDDDERADDSLFMMKELAGAKVERPPSP
FSAAPQAPLPPVPPRLDLLQQRLPGPAGAGLGAAPKAASALHKDKPLPAPPTLRDLPPPP
PPDRPYSGGAEARPQRRPLPCTPGDSPSRDKLPPVPSSRLGESWLPRPVPRVPVVTPSPG
EPWAGRELTNRHSLPFSLPSQMEPRAEGPWPGSAFGPDASVNMNSSPLAGPECEHPKIKP
SASANAIYSLAARELPGQNMAARQLCNGGGPSTGTMTPARTPFPATVPDNPVPPYISLVC
RNCLGLQQLSLSHNPHCFLQPKVMGTSLPSSGALGWGSGREVHSTTGLPPSPHTHTPSLW
PPPHCCLCHRVLSFLSQCLLSFGLSLGGVAGAYFTEGAPVPERPPKPFPRRINSERKAGP
GHPGATAATSPQLSSEIESLLSQGYSHQDIQKALLIAHNNIDMAKNILREFVSISSPTHV
AT
Download sequence
Identical sequences G1P6X5
ENSMLUP00000005839 ENSMLUP00000005839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]