SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005860 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005860
Domain Number 1 Region: 128-199
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 441-514
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-20
Family SH3-domain 0.00086
Further Details:      
 
Domain Number 3 Region: 802-887
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-17
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 193-260
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000144
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 10-67
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000134
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005860   Gene: ENSMLUG00000006412   Transcript: ENSMLUT00000006415
Sequence length 888
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:31278685:31441140:-1 gene:ENSMLUG00000006412 transcript:ENSMLUT00000006415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGV
EELPSNILLVRLLDGIKQRPWKPGPGGGSGTNCTSALRVQSSSVANCCSKDLPSSQGGQQ
PRVQAWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIH
GFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEG
MLADKIGIFPISYVEFNSAAKQLIEWDKPPGPGADAGEGTSAAAQGSTASKHSDTKKNTK
KRHSFTSLTMANKSSQASQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHIS
TTGLIVTPPPSSPVTTGPSFTFPSDVPYTAALGTMNPPLPPPPLLVSTPPGAAAAAAAAA
AAAGTGPRPTAGPTDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDG
WFKGTSMHTSKIGVFPGNYVAPVTSFGRAMTNASQAKVPVSTAGQTSRGVTMVSPSTAGG
PAQKLQGNGMAGSPNVVPTAVVSAAHMHTSPQAKVLLNMTGQMTVNQARNAVRTVLAHNQ
ERPTAAVTPIQVQNASGLGPASVGLPHHPLASPQPPPPMAAINMGRASAPLACAAAASIT
SPSLTSTSLETEPSSQIMAILSGLPASPDSASSACGNSSAAKPDKDSKKERKGLLKLLSG
ASTKRKPRVSPPASPTLEVELGGGGGGGGSELPLQGAVGPELPLGGAHGRAGSCPMDGDG
PAQAVAVGAALAQEVLHRKTSSLDSAVPIAPPPRQPCSSLGSVMNESRPVVCERHRVVVS
YPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNKTGLFPGSFVENI
Download sequence
Identical sequences G1P6Z3
ENSMLUP00000005860 ENSMLUP00000005860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]