SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005893 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005893
Domain Number 1 Region: 439-549
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-30
Family SH2 domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 119-213
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-24
Family Ras-binding domain, RBD 0.00022
Further Details:      
 
Domain Number 3 Region: 240-368
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005893   Gene: ENSMLUG00000006445   Transcript: ENSMLUT00000006452
Sequence length 552
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430665:89865:118426:1 gene:ENSMLUG00000006445 transcript:ENSMLUT00000006452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENDIDLEGLVNDMNTSLESLCPSSNMQSETVPLRQNGQHTRGQPPPAGARPAEPQASAQQ
KVQRSQPMHILAVRRLQEEDQQLKTSSLPAIPNPFPELGKKPLQSVPTPPFLLPSRWPAR
SLQKQDVKIFGEDGTCKVVEIPVDMKSRDLCQLLVYRSHCVDDNSWTLVEFHPHLGIERC
LEDHELVAQVDSTMAGESKFLFRKNYGKYEFFKNPTNFFPDQMVTWCQQSNGGQNQLLQN
FLNTSSCPEIQGFLHVKELGRKSWKKMYLCLRRSGLYCSTKGSSKEPRHLQLLADLDDCS
VFSVISGKKQYHTPTEFGFCLKPNKVLQETKELRVLCAEDEQGRICWMTAFRLLKYGMTL
YQNYRLPHHRKAAYLSSLSGPVRSVSESSLVAMDFSGQTGRVIDNPDEAESAALEEGHAW
RRRSTRMSALGSQSPLAHSSLNTVIHKSQHWFHGRISREESHRIIKQQGLVDGLFLVRDS
QSNPKAYVLTLSHHQKIKNFQILPCEEEGQVFFSLDDGNTKFSDLIQLVDFYQLNKGVLP
CKLKHHCVRVAL
Download sequence
Identical sequences G1P723
ENSMLUP00000005893 ENSMLUP00000005893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]