SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005916 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005916
Domain Number 1 Region: 117-248
Classification Level Classification E-value
Superfamily GAT-like domain 5.49e-47
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.00000103
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.63e-35
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005916   Gene: ENSMLUG00000006464   Transcript: ENSMLUT00000006478
Sequence length 879
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429838:113404:194968:1 gene:ENSMLUG00000006464 transcript:ENSMLUT00000006478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKHINIYLIQATNETNVNIPQMADTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQY
LASRNTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQMAFDFARVKKGADGVM
RTMVPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVI
NLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLME
TLEQHLNTLEGKKPGNNEKSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATPSA
AVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPAPPSGGATAWGDLLGEDSLATLSSAPS
EAQISDPFASEPTPPTTAAEIATASASASTTTTVTAVTAEVDLFGDCTQDAFAASPGEAP
AASEGAAAAATPTPVAAALDACSGNEDPFAPSEGSAEAAPELDLFAMKPPETSVPVVTPT
ASTAPPVPATAPSPAPAIAAATAATTAATTATAVTATTSATTTTTTTAPPALDIFGDLFE
SAPEVAAAPKPDAAPSIDLFGTEDAFSSPPQGASPVPESSLTADLLSVDTFASPAPATTA
SPAKVDSSGVIDLFGDAFGTSASEPQPAPQAASSSSASADLLAGFGGSFMAPSPSPVTPA
QNNLLQPNFEAAFGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPTGQPAPISMVPPSPAVA
ASKPLGSDLDSSLASLVGNLGISGTTSKKGDLQWNAGEKKLTGGANWQPKVAPATWSTGV
PSSAPLQGAVPPTSSVPPGAGAPTVGQPGAGFGMPPAGTGMPMMPQQPVMFAQPMMRPPF
GAAAVPGTQLSPSPTPATQSPKKPPAKDPLADLNIKDFL
Download sequence
Identical sequences G1P742
ENSMLUP00000005916 ENSMLUP00000005916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]