SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006209 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006209
Domain Number 1 Region: 34-502
Classification Level Classification E-value
Superfamily Sema domain 1.27e-127
Family Sema domain 0.000023
Further Details:      
 
Domain Number 2 Region: 1344-1473,1669-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.54e-50
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 946-1034
Classification Level Classification E-value
Superfamily E set domains 1.16e-17
Family E-set domains of sugar-utilizing enzymes 0.087
Further Details:      
 
Domain Number 4 Region: 1035-1136
Classification Level Classification E-value
Superfamily E set domains 0.000000000000458
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 5 Region: 850-947
Classification Level Classification E-value
Superfamily E set domains 0.00000000000152
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 505-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000275
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 1133-1214
Classification Level Classification E-value
Superfamily E set domains 0.0000000882
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 802-836
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000837
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006209   Gene: ENSMLUG00000006775   Transcript: ENSMLUT00000006800
Sequence length 1888
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430320:32241:217263:-1 gene:ENSMLUG00000006775 transcript:ENSMLUT00000006800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPWPRAEVDSRSVVLLSVVWVLLAPPAAGMPQFSTFHSENRDWTFNHLTVHRGTGAVYVG
AINRVYKLTGNLTIQVAHMTGPREDNKSCYPPLTVQPCSEALTLTNNVNKLLIIDYPENR
LLACGSLYQGVCKLLRLDDLFILAEPFHKKEHYLSSVNKTGTMYGVIVRSEGQDGKLFIG
TAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFDIFYIY
GFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKNDPKFHSYVSLPFGCTRAGV
EYRLLQAAYLAKPGASLAQAFNISSQDDVLFAIFSKGQKQYHHPPDDSALCAFPIPAINL
QIKERLQSCYQGEGHLELNWLLGKEVQCTKAPVPIDDNFCGLDINQPLGGSTPVEGLTLY
TTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRD
MAFTDQRYLYVMSERQITRVPVESCEQYTTCVECLSSGDPHCGWCALHNMCSRRDKCQRA
WEPNRFAASISQCMSLEVRPSSISVSEHSRQLSLVVNDAPDLSAGIKCAFGNLTEVEGQV
SGTQVICISPGPKDVPVIPLDQADWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSC
VNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEVKPITLKAR
NLPQPQSGQRGYECVLNIQGAVHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVW
NGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCASPSSPW
LDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLP
GEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLNPVRGP
ESGGTMVTITGRYLGAGSSVAVYLGNQTCEFYGRSMNEIVCVSPPSSNGQSCVPVFVSVD
RARVNNSLKFEYIGDPQVQSIEPEWSIASGHTPLTITGSLDVIQEPRIRVKFNGKESVNV
CKVVNNTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYYPNPTFE
LLSPTGVLNQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLLCEPPNL
TGQHKVMVHVGGMVFSPGSVSVVSDSLLTLPAIVSIAAGGSLLLIIVIIVLIAYKRKSRE
NDLTLKRLQMQMDNLESRVALECKEAFAELQTDIIELTSDLDRSGIPYLDYRTYAMRVLF
PGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNV
ASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLL
HKFLKECAAEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVN
PDNENSPEIPVKVLNCDTITQVKEKILDAIYKNVPYSQRPRAVDMDLEWRQGRIARVVLQ
DEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFR
YTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKG
TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLR
FWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPS
YKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFHMLSALNEIYSYVSKYSEELIG
ALEQDEQARRQRLAYKVEQLINAMSIES
Download sequence
Identical sequences G1P7U6
ENSMLUP00000006209 ENSMLUP00000006209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]