SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006299 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006299
Domain Number 1 Region: 1411-1515
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-29
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 231-333
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-27
Family PDZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 1659-1756
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-25
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 4 Region: 339-451
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-25
Family PDZ domain 0.0016
Further Details:      
 
Domain Number 5 Region: 1221-1318
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family PDZ domain 0.027
Further Details:      
 
Domain Number 6 Region: 1516-1607
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-22
Family PDZ domain 0.0038
Further Details:      
 
Domain Number 7 Region: 1062-1160
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 8 Region: 676-771
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-21
Family PDZ domain 0.017
Further Details:      
 
Domain Number 9 Region: 122-225
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-20
Family PDZ domain 0.0051
Further Details:      
 
Domain Number 10 Region: 4-64
Classification Level Classification E-value
Superfamily L27 domain 6.67e-20
Family L27 domain 0.0000731
Further Details:      
 
Domain Number 11 Region: 566-638
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000605
Family PDZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006299   Gene: ENSMLUG00000006861   Transcript: ENSMLUT00000006895
Sequence length 1787
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429830:1110176:1373998:1 gene:ENSMLUG00000006861 transcript:ENSMLUT00000006895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPENPATDKLQVLPILDRLKVKLQEKGDTSQIEKLSMFYETLKSPLFNQILTLQQSIKQL
KGQLSHLPSDCSANFDFSRKGLLVFTDGAITNGNVQRSSNNLTVSGLFPWTPKLGNEDFN
SIIQQMAQGRQIEYIDIERPSTGGLGFSVVALRSQNLGEIDIFVKEIQPGSIADRDQRLK
ENDQILAINHTPLDQNISHQQAIALLQQTTGCLSLVVARQPVHTKSRTSLTDTILPETVR
WGHIEDVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTNVQ
GMTSEQVAQVLRNCGNSVRMLVARDPIGEISVTPPTPTALPVALPAVPNRSPSSDNSLYE
TYNVELIKKDGQSLGIRIVGYVGSAHTGEASGIYVKSVIPGSAAYHNGQIQVNDKIVAVD
GVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSSPASPLVEEPPLVGTVVEPPKPPALSL
AGAVDTETNLDVEDEETEERMDDLKNDNIQALEKPERAPDFSENELKSRWENILGPDYEV
MVATLDTQIAEIFKGKHYYFLLPIHTLRLGMEVDSFDGHHYISSIVPGGPIDTLSLLQPE
DELLEFNGVQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTTAASPPEMEA
DHNVDVNTEEDDDGELALWSPEVKIVELVKDHKGLGFSILDYQDPLDSTRSVIVIRSLVA
DGVAERSGELLPGDRLVSVNQYCLDNTKLADAVEVLKAVPPGTVRLGICKPLGEDDKEEE
SHYLLHSNTNEDKTEISGTIHDINSSLILEAPKEFRDEPYFKEELVDEPLLNLGRSFQFQ
QKEIDNSKEAWEMHEFLTPGLQEMGEEREMLVDEEYELYQDSFPSMELCPSSHIQEAAPV
LSMKELHFGTQWFCDNEPPEPQEARSMMSVYSPETQQYGYSTENVMKENFGIISHPSISS
TEGNSQQGRFDDLENLNSLTQSSLELGMMIPNDVQGPGLLVELPAMAQRRQQEDLPLYQL
PRIRVVSKTSAHTGMLSSRYSTDAYELPEREEGEGEETPNFSHWGPPRIVEIFREPDVSL
GISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHS
EAVEAIKNAGNPVVFVVQSLSSTPRVSFRLCFQRVAFSQILHLQRQGTAPPPMKLPPPYR
APSEDSDDNEEECAFTNKKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFV
VGINPEGPAATDGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKIKLVFIRNEDAVN
QMAVAPVPLPSSSPSFIEDQSSPEPVSSEEDGSLGVGTKQLPESESSKLAVSQMKQQKYS
TKVSFSSQEIPLAPAPSYHSTDAVATGCGGFQAPLSVDPATCPIVPGQEMIIEISKGHSG
LGLSIVGGRDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNASHEEAITALR
HTPQKVRLVVYRDETHYRDEENLEFFPVDLQKKAGRGLGLSIVGKRNGNGVFISDIVKGG
AADLDGRLMRGDQILSVNGEDMRNASQETVATVLKCAQGLVQLEIGRLRAGSWAASRKTS
QNSQGSQHSTHSSFHPALAPVISSLQSLVGTKKASDPSPRNSGTDMGPRTVEIIREPSDA
LGISIAGGKGSPLGDIPIFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNL
LKNAYGRIILQVVADTNISAIATQLENLSTGYHLGSPTADHHPEDTE
Download sequence
Identical sequences G1P825
ENSMLUP00000006299 ENSMLUP00000006299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]