SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006380 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006380
Domain Number 1 Region: 727-1079
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.32e-54
Family Ankyrin repeat 0.0000391
Further Details:      
 
Domain Number 2 Region: 443-713
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.6e-41
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 3 Region: 222-410,441-521
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.54e-37
Family Ankyrin repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 48-158
Classification Level Classification E-value
Superfamily POZ domain 2.2e-20
Family BTB/POZ domain 0.006
Further Details:      
 
Domain Number 5 Region: 1104-1163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006380   Gene: ENSMLUG00000006963   Transcript: ENSMLUT00000006979
Sequence length 1169
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430424:150750:195984:-1 gene:ENSMLUG00000006963 transcript:ENSMLUT00000006979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCTLLAAQANKENSSESFISRLLTIVAD
LYEQEQYSDLKIKVGGRHINAHKFVLAARSDSWSLANLSSTKELDLSADANPEVTMTMLR
WIYTDELEFKEDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNA
STLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLI
EMDSQLPGKLNELDQNGDLALDLALSRRLESIATTLVSHRADVDMVDKNGWSLLHKGIQR
GDVFASTFLIKNGAHVSAATLSAQETPLHLVALYSSKKHSADVMSAMAQIAEALLQAGAN
PNMQDSKGRTPLHLSIVARNEYVFNQLLQCKQLDLELKDHEGSTALWLAVQYITVSSDQS
VNPFEDLPVVNGTSFDENSFAARLIQRGSNTNAPDSKTGNCLLQRAAEAGNEAAGLKKSE
TGACILKYCWGETPLHTACRHGLANLTAELLQQGANPNLQTEEAPPLPKEAASLASSVGS
VYLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTG
MHTIAAQLLGSGAGINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTRDGETALQ
LAIKNQLPLVVDAICTRGADMSVPDERGDPPLWLALANNLEDIASTLVRHGCDSTCWGPG
PSGCLQTLLHRAIDENNESTTCFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASW
GLEETVQCLLEFGANVNAQDAEGRTPIHVAISNQHSVIIQLLISHPDIHLNVRDRQGLTP
FACAMTYKNNKAAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSR
VQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLE
NGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKEN
AAAIFDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNI
FNYQVATKQLLFRLLDMLSKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTK
EIPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences G1P891
ENSMLUP00000006380 ENSMLUP00000006380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]