SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006663 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006663
Domain Number 1 Region: 17-177
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 2.49e-60
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0000000364
Further Details:      
 
Domain Number 2 Region: 200-373
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.45e-31
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.0000000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006663   Gene: ENSMLUG00000007303   Transcript: ENSMLUT00000007302
Sequence length 408
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430422:271025:286156:-1 gene:ENSMLUG00000007303 transcript:ENSMLUT00000007302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMRWLRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPV
RLANIMKEINLLPDRVLGTPSVQLVQSWYVQSLLDIMVFLDKDPEDQRTLSQFTEALVTI
RNRHNDVVPTMAQGVLEYKDAYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGS
TNPAHPKHIGSIDPNCCISEVVKDAYDMAKLLCDKYYMASPDLEIQEINASDSKQPIHMV
YVPSHLYHMLFELFKNAMRATVESHESSLVLPPVKVMVALGEEDLSIKMSDRGGGVPLRK
IEQLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIY
LKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVT
Download sequence
Identical sequences G1P8Z0
ENSMLUP00000006663 ENSMLUP00000006663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]