SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006813 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006813
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.01e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000665
Further Details:      
 
Domain Number 2 Region: 182-306
Classification Level Classification E-value
Superfamily E set domains 1.12e-44
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006813   Gene: ENSMLUG00000007454   Transcript: ENSMLUT00000007464
Sequence length 586
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:3209060:3233161:-1 gene:ENSMLUG00000007454 transcript:ENSMLUT00000007464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISGGYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIKNCYGKGKV
RITLVTKNDPFKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIIS
RIRAGINPFNVPEPQLLDTEDCDLNVVRLCFQVFLYDEHGNLTTTLPPVVSNPIYDNRAP
NTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFALNDWEAKGIFSQADVHRQVA
IVFKTPPYCKVITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTSLLFQ
KLWQDCAVNFPERPRPGPLGSTGEGRFIKKESNSFPHGAVLNEMLRPAGVSSQAESYYSS
SVSISSAMPHHASAMPPMVPQPSSHWSSEPHPPSCSVSTNPLSSFATGTISSNSRFPEMH
VVNDLHASNACIYNSTNDIGRMETSSLSSADFCGFSGANMLQNCPVNISNNDSMRETDNS
GFTRMNMGSPSCNSVLDQRDLRQFHQMSSSSVPAGASSGTTAFASQSDAFEGSDFSCAEN
SMLNESGPLNGTNPNGHGFAQSQYSGIGTMQNEQLSDQYTFEYFTD
Download sequence
Identical sequences G1P9B7
ENSMLUP00000006813 ENSMLUP00000006813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]