SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007103 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007103
Domain Number 1 Region: 450-614
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 628-751
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 743-827
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-16
Family PDZ domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007103   Gene: ENSMLUG00000007778   Transcript: ENSMLUT00000007778
Sequence length 834
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429798:160933:222496:-1 gene:ENSMLUG00000007778 transcript:ENSMLUT00000007778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPLEGAAEVEVTDEAAGGEVNESVEADLERPEVEEEQQQQQHHAGRPPRALAVEDPRAQ
PAPPEEEERGECLARSASTESGFHNHTDTAEGDVIAAARDGDDPERTQDPEDESAYAVQY
RPEAEEYTEQAEAEHAEATHRLALPNHLHFHSLEQEEAMTAAYSGYVYTHRLFHRGEDEP
YAEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDEEAAYRQEALGARLHHYDERS
DGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLER
APTPGGGHPDSPGPPAPAGQQRAAGTVVGEAVQRYSKEKRDAISLAIKDIKEAIEEVKTR
TIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPGDGDSPSPGSSSPLGAKSSSTPLHPSD
PAEGSANKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRM
MQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLR
TISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQS
IGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQK
GEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQ
SIIKGLKNQARVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVR
VGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences G1PA16
XP_006086859.1.53796 XP_014309573.1.53796 ENSMLUP00000007103 ENSMLUP00000007103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]