SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007735 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000007735
Domain Number - Region: 57-138
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family IMD domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007735   Gene: ENSMLUG00000008489   Transcript: ENSMLUT00000008482
Sequence length 206
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429978:1607311:1624922:-1 gene:ENSMLUG00000008489 transcript:ENSMLUT00000008482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASNASVGSGCEEKGREGSSPEPVSPDTTISRMKLLDTTVDTFLQKLVAAGSYQRFTD
CYKRFYQLQPEMTQRIYDKFLTQLQTSIREEISEIKAEGNLEAVLTALDTIVEEGKDRKE
PAWRPSGIPEKDLRSTMVPYFLQQRDALRRRVQRQEAENRQLADAVLAGRRQVEELQLQG
QAQWQAWQMAGSAQRTEGAGGHAEGA
Download sequence
Identical sequences G1PBJ7
ENSMLUP00000007735 ENSMLUP00000007735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]