SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007935 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007935
Domain Number 1 Region: 348-610
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-72
Family Nuclear receptor ligand-binding domain 0.000000000109
Further Details:      
 
Domain Number 2 Region: 275-353
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007935   Gene: ENSMLUG00000008683   Transcript: ENSMLUT00000008708
Sequence length 612
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429856:1310721:1315617:1 gene:ENSMLUG00000008683 transcript:ENSMLUT00000008708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFLENACACNSAEAMPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDL
TNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQTPLPGQQASIKVEDIQMHSYQQHSHL
PPQSEEMMPHSGSVYYKPSSPPTSATPGFPVQHSPMWDDPGSLHNFHQNYVATTHMIEQR
KTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRK
PASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGF
FKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLP
SKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQF
YDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCN
GVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEE
LQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPA
IIDKLFLDTLPF
Download sequence
Identical sequences G1PC13
ENSMLUP00000007935 ENSMLUP00000007935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]